Lineage for d2i3qa_ (2i3q A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1919359Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
    alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243
  4. 1919370Superfamily d.95.2: Homing endonucleases [55608] (3 families) (S)
  5. 1919371Family d.95.2.1: Group I mobile intron endonuclease [55609] (6 proteins)
    contains two extra helices in the C-terminal extension
  6. 1919427Protein automated matches [190411] (4 species)
    not a true protein
  7. 1919440Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [187286] (9 PDB entries)
  8. 1919457Domain d2i3qa_: 2i3q A: [165379]
    automated match to d1bp7a_
    protein/DNA complex; complexed with ca; mutant

Details for d2i3qa_

PDB Entry: 2i3q (more details), 2.3 Å

PDB Description: q44v mutant of homing endonuclease i-crei
PDB Compounds: (A:) DNA endonuclease I-crei

SCOPe Domain Sequences for d2i3qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i3qa_ d.95.2.1 (A:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
ntkynkefllylagfvdgdgsiiaqiapnqsykfkhqlsltfvvtqktqrrwfldklvde
igvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
flevctwvdqiaalndsktrkttsetvravld

SCOPe Domain Coordinates for d2i3qa_:

Click to download the PDB-style file with coordinates for d2i3qa_.
(The format of our PDB-style files is described here.)

Timeline for d2i3qa_: