![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.14: vp4 sialic acid binding domain [74907] (2 proteins) automatically mapped to Pfam PF00426 |
![]() | Protein automated matches [190699] (4 species) not a true protein |
![]() | Species Rotavirus c [TaxId:10913] [187837] (1 PDB entry) |
![]() | Domain d2i2sb1: 2i2s B:64-224 [165376] Other proteins in same PDB: d2i2sa2, d2i2sb2 automated match to d1kqra_ complexed with gol, mna, mpd, na, so4 |
PDB Entry: 2i2s (more details), 2.3 Å
SCOPe Domain Sequences for d2i2sb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i2sb1 b.29.1.14 (B:64-224) automated matches {Rotavirus c [TaxId: 10913]} lldgpyqpttfnpptsywillaptvegvviqgtnnidrwlatiliepnvqttnriynlfg qqvtlsventsqtqwkfidvskttptgnytqhgslfstpklyavmkfsgriytyngttpn attgyysttnydtvnmtsfcdfyiiprnqeekcteyinhgl
Timeline for d2i2sb1: