Lineage for d2i2sb1 (2i2s B:64-224)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780402Family b.29.1.14: vp4 sialic acid binding domain [74907] (2 proteins)
    automatically mapped to Pfam PF00426
  6. 2780411Protein automated matches [190699] (4 species)
    not a true protein
  7. 2780422Species Rotavirus c [TaxId:10913] [187837] (1 PDB entry)
  8. 2780424Domain d2i2sb1: 2i2s B:64-224 [165376]
    Other proteins in same PDB: d2i2sa2, d2i2sb2
    automated match to d1kqra_
    complexed with gol, mna, mpd, na, so4

Details for d2i2sb1

PDB Entry: 2i2s (more details), 2.3 Å

PDB Description: crystal structure of the porcine crw-8 rotavirus vp8* carbohydrate- recognising domain
PDB Compounds: (B:) Outer capsid protein VP4

SCOPe Domain Sequences for d2i2sb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i2sb1 b.29.1.14 (B:64-224) automated matches {Rotavirus c [TaxId: 10913]}
lldgpyqpttfnpptsywillaptvegvviqgtnnidrwlatiliepnvqttnriynlfg
qqvtlsventsqtqwkfidvskttptgnytqhgslfstpklyavmkfsgriytyngttpn
attgyysttnydtvnmtsfcdfyiiprnqeekcteyinhgl

SCOPe Domain Coordinates for d2i2sb1:

Click to download the PDB-style file with coordinates for d2i2sb1.
(The format of our PDB-style files is described here.)

Timeline for d2i2sb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2i2sb2