SCOPe 2.08: Domain d2i2sa1: 2i2s A:64-224

Lineage for d2i2sa1 (2i2s A:64-224)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.14: vp4 sialic acid binding domain [74907] (2 proteins)
   automatically mapped to Pfam PF00426

6. Protein automated matches [190699] (4 species)
   not a true protein

7. Species Rotavirus c [TaxId:10913] [187837] (1 PDB entry)

8. Domain d2i2sa1: 2i2s A:64-224 [165375]
   Other proteins in same PDB: d2i2sa2, d2i2sb2
   automated match to d1kqra_
   complexed with gol, mna, mpd, na, so4

Details for d2i2sa1

PDB Entry: 2i2s, 2.3 Å

PDB Description: crystal structure of the porcine crw-8 rotavirus vp8* carbohydrate- recognising domain

PDB Compounds: (A:) Outer capsid protein VP4

SCOPe Domain Sequences for d2i2sa1:

Sequence; same for both SEQRES and ATOM records:

>d2i2sa1 b.29.1.14 (A:64-224) automated matches {Rotavirus c [TaxId: 10913]}
lldgpyqpttfnpptsywillaptvegvviqgtnnidrwlatiliepnvqttnriynlfg
qqvtlsventsqtqwkfidvskttptgnytqhgslfstpklyavmkfsgriytyngttpn
attgyysttnydtvnmtsfcdfyiiprnqeekcteyinhgl

Timeline for d2i2sa1:

• d2i2sa1 first appeared in SCOPe 2.01, called d2i2sa_
  
• d2i2sa1 appears in SCOPe 2.07