Lineage for d1wata_ (1wat A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 535478Fold a.24: Four-helical up-and-down bundle [47161] (24 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 535497Superfamily a.24.2: Aspartate receptor, ligand-binding domain [47170] (1 family) (S)
  5. 535498Family a.24.2.1: Aspartate receptor, ligand-binding domain [47171] (1 protein)
  6. 535499Protein Aspartate receptor, ligand-binding domain [47172] (2 species)
  7. 535502Species Salmonella typhimurium [TaxId:90371] [47174] (7 PDB entries)
  8. 535511Domain d1wata_: 1wat A: [16537]

Details for d1wata_

PDB Entry: 1wat (more details), 3 Å

PDB Description: the three-dimensional structure of the ligand-binding domain of a wild-type bacterial chemotaxis receptor

SCOP Domain Sequences for d1wata_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wata_ a.24.2.1 (A:) Aspartate receptor, ligand-binding domain {Salmonella typhimurium}
gfvisnelrqqqseltstwdlmlqtrinlsrsaarmmmdasnqqssaktdllqnakttla
qaaahyanfknmtplpamaeasanvdekyqryqaalaeliqfldngnmdayfaqptqgmq
nalgealgnyarvsenlyrqtf

SCOP Domain Coordinates for d1wata_:

Click to download the PDB-style file with coordinates for d1wata_.
(The format of our PDB-style files is described here.)

Timeline for d1wata_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1watb_