SCOPe 2.01: Domain d2i0wa_: 2i0w A:

Lineage for d2i0wa_ (2i0w A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
   sandwich; 11 strands in 2 sheets

4. Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families)
   has two smaller insertion domains

5. Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)

6. Protein automated matches [190195] (3 species)
   not a true protein

7. Species Solanum lycopersicum [TaxId:4081] [187355] (1 PDB entry)

8. Domain d2i0wa_: 2i0w A: [165367]
   automated match to d1pcva_
   complexed with cl

Details for d2i0wa_

PDB Entry: 2i0w, 2.5 Å

PDB Description: Crystal structure analysis of NP24-I, a thaumatin-like protein

PDB Compounds: (A:) Protein NP24

SCOPe Domain Sequences for d2i0wa_:

Sequence; same for both SEQRES and ATOM records:

>d2i0wa_ b.25.1.1 (A:) automated matches {Solanum lycopersicum [TaxId: 4081]}
atievrnncpytvwaastpigggrrlnrgqtwvinaprgtkmariwgrtgcnfnaagrgt
cqtgdcggvlqctgwgkppntlaeyaldqfsnldfwdislvdgfnipmtfaptkpsggkc
haihctaningecpralkvpggcnnpcttfggqqycctqgpcgptelskffkkrcpdays
ypqddptstftcpggstnyrvvfcpng

Timeline for d2i0wa_:

• d2i0wa_ is new in SCOPe 2.01-stable
  
• d2i0wa_ appears in SCOPe 2.02
  
• d2i0wa_ appears in the current release, SCOPe 2.08