![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily) sandwich; 11 strands in 2 sheets |
![]() | Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) ![]() has two smaller insertion domains |
![]() | Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins) automatically mapped to Pfam PF00314 |
![]() | Protein automated matches [190195] (6 species) not a true protein |
![]() | Species Solanum lycopersicum [TaxId:4081] [187355] (1 PDB entry) |
![]() | Domain d2i0wa_: 2i0w A: [165367] automated match to d1pcva_ complexed with cl |
PDB Entry: 2i0w (more details), 2.5 Å
SCOPe Domain Sequences for d2i0wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i0wa_ b.25.1.1 (A:) automated matches {Solanum lycopersicum [TaxId: 4081]} atievrnncpytvwaastpigggrrlnrgqtwvinaprgtkmariwgrtgcnfnaagrgt cqtgdcggvlqctgwgkppntlaeyaldqfsnldfwdislvdgfnipmtfaptkpsggkc haihctaningecpralkvpggcnnpcttfggqqycctqgpcgptelskffkkrcpdays ypqddptstftcpggstnyrvvfcpng
Timeline for d2i0wa_: