Lineage for d2i0wa_ (2i0w A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777878Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. 2777879Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) (S)
    has two smaller insertion domains
  5. 2777880Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)
    automatically mapped to Pfam PF00314
  6. 2778007Protein automated matches [190195] (6 species)
    not a true protein
  7. 2778054Species Solanum lycopersicum [TaxId:4081] [187355] (1 PDB entry)
  8. 2778055Domain d2i0wa_: 2i0w A: [165367]
    automated match to d1pcva_
    complexed with cl

Details for d2i0wa_

PDB Entry: 2i0w (more details), 2.5 Å

PDB Description: Crystal structure analysis of NP24-I, a thaumatin-like protein
PDB Compounds: (A:) Protein NP24

SCOPe Domain Sequences for d2i0wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i0wa_ b.25.1.1 (A:) automated matches {Solanum lycopersicum [TaxId: 4081]}
atievrnncpytvwaastpigggrrlnrgqtwvinaprgtkmariwgrtgcnfnaagrgt
cqtgdcggvlqctgwgkppntlaeyaldqfsnldfwdislvdgfnipmtfaptkpsggkc
haihctaningecpralkvpggcnnpcttfggqqycctqgpcgptelskffkkrcpdays
ypqddptstftcpggstnyrvvfcpng

SCOPe Domain Coordinates for d2i0wa_:

Click to download the PDB-style file with coordinates for d2i0wa_.
(The format of our PDB-style files is described here.)

Timeline for d2i0wa_: