![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
![]() | Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) ![]() |
![]() | Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
![]() | Protein automated matches [190139] (27 species) not a true protein |
![]() | Species Vipera nikolskii [TaxId:110206] [187834] (1 PDB entry) |
![]() | Domain d2i0ua_: 2i0u A: [165364] automated match to d1jltb_ complexed with ca, so4, tfa, trt |
PDB Entry: 2i0u (more details), 2.2 Å
SCOPe Domain Sequences for d2i0ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i0ua_ a.133.1.2 (A:) automated matches {Vipera nikolskii [TaxId: 110206]} nlfqfakmingklgafsvwnyisygcycgwggqgtpkdatdrccfvhdccygrvrgcnpk laiyaysfkkgnivcgknngclrdicecdrvaancfhqnqntynknykflsssrcrqtse qc
Timeline for d2i0ua_: