SCOPe 2.08: Domain d2i0ua_: 2i0u A:

Lineage for d2i0ua_ (2i0u A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein automated matches [190139] (27 species)
   not a true protein

7. Species Vipera nikolskii [TaxId:110206] [187834] (1 PDB entry)

8. Domain d2i0ua_: 2i0u A: [165364]
   automated match to d1jltb_
   complexed with ca, so4, tfa, trt

Details for d2i0ua_

PDB Entry: 2i0u, 2.2 Å

PDB Description: Crystal structures of phospholipases A2 from Vipera nikolskii venom revealing Triton X-100 bound in hydrophobic channel

PDB Compounds: (A:) Basic subunit of heterodimer phospholipase A2

SCOPe Domain Sequences for d2i0ua_:

Sequence; same for both SEQRES and ATOM records:

>d2i0ua_ a.133.1.2 (A:) automated matches {Vipera nikolskii [TaxId: 110206]}
nlfqfakmingklgafsvwnyisygcycgwggqgtpkdatdrccfvhdccygrvrgcnpk
laiyaysfkkgnivcgknngclrdicecdrvaancfhqnqntynknykflsssrcrqtse
qc

Timeline for d2i0ua_:

• d2i0ua_ first appeared in SCOPe 2.01
  
• d2i0ua_ appears in SCOPe 2.07