SCOPe 2.03: Domain d2i0td_: 2i0t D:

Lineage for d2i0td_ (2i0t D:)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
   disulfide-rich; nearly all-beta

4. Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families)

5. Family g.21.1.0: automated matches [191380] (1 protein)
   not a true family

6. Protein automated matches [190474] (1 species)
   not a true protein

7. Species Alcaligenes faecalis [TaxId:511] [187398] (27 PDB entries)

8. Domain d2i0td_: 2i0t D: [165362]
   automated match to d1mg2b_
   complexed with pel

Details for d2i0td_

PDB Entry: 2i0t, 1.35 Å

PDB Description: Crystal structure of phenylacetaldehyde derived R-carbinolamine adduct of aromatic amine dehydrogenase

PDB Compounds: (D:) Aromatic amine dehydrogenase

SCOPe Domain Sequences for d2i0td_:

Sequence; same for both SEQRES and ATOM records:

>d2i0td_ g.21.1.0 (D:) automated matches {Alcaligenes faecalis [TaxId: 511]}
hislnpdlanedevnscdywrhcavdgflcsccggttttcppgstpspiswigtchnphd
gkdylisyhdccgktacgrcqcntqtrerpgyefflhndvnwcmanenstfhcttsvlvg
l

Timeline for d2i0td_:

• d2i0td_ first appeared in SCOPe 2.01
  
• d2i0td_ appears in SCOPe 2.02
  
• d2i0td_ appears in SCOPe 2.04
  
• d2i0td_ appears in the current release, SCOPe 2.08