Lineage for d2i0jd_ (2i0j D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008578Protein Estrogen receptor alpha [48519] (1 species)
  7. 2008579Species Human (Homo sapiens) [TaxId:9606] [48520] (64 PDB entries)
    Uniprot P03372 307-551
  8. 2008689Domain d2i0jd_: 2i0j D: [165355]
    automated match to d1pcga_
    complexed with i0g

Details for d2i0jd_

PDB Entry: 2i0j (more details), 2.9 Å

PDB Description: benzopyrans are selective estrogen receptor beta agonists (serbas) with novel activity in models of benign prostatic hyperplasia
PDB Compounds: (D:) Estrogen receptor alpha

SCOPe Domain Sequences for d2i0jd_:

Sequence, based on SEQRES records: (download)

>d2i0jd_ a.123.1.1 (D:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
gfvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveif
dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
lihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvplydlllemld
ah

Sequence, based on observed residues (ATOM records): (download)

>d2i0jd_ a.123.1.1 (D:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
lalsltadqmvsalldaeppilyseydsmmglltnladrelvhminwakrvpgfvdltlh
dqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifdmllatss
rfrmmnlqgeefvclksiillnsgvytfstlksleekdhihrvldkitdtlihlmakagl
tlqqqhqrlaqlllilshirhmsnkgmehlysmlydlllemldah

SCOPe Domain Coordinates for d2i0jd_:

Click to download the PDB-style file with coordinates for d2i0jd_.
(The format of our PDB-style files is described here.)

Timeline for d2i0jd_: