SCOPe 2.01: Domain d2hzqa_: 2hzq A:

Lineage for d2hzqa_ (2hzq A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.0: automated matches [191454] (1 protein)
   not a true family

6. Protein automated matches [190698] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187833] (4 PDB entries)

8. Domain d2hzqa_: 2hzq A: [165344]
   automated match to d1bbpa_
   complexed with str

Details for d2hzqa_

PDB Entry: 2hzq, 1.8 Å

PDB Description: crystal structure of human apolipoprotein d (apod) in complex with progesterone

PDB Compounds: (A:) Apolipoprotein D

SCOPe Domain Sequences for d2hzqa_:

Sequence; same for both SEQRES and ATOM records:

>d2hzqa_ b.60.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fhlgkcpnppvqenfdvnkypgrwyeiekipttfengrciqanyslmengkikvlnqelr
adgtvnqiegeatpvnltepaklevkfswfmpsapyhilatdyenyalvysctsisqsfh
vdfawilarnvalppetvdslkniltsnnidvkkmtvtdqvncpkl

Timeline for d2hzqa_:

• d2hzqa_ is new in SCOPe 2.01-stable
  
• d2hzqa_ appears in SCOPe 2.02
  
• d2hzqa_ appears in the current release, SCOPe 2.08