SCOPe 2.01: Domain d2hzia_: 2hzi A:

Lineage for d2hzia_ (2hzi A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Abelsone tyrosine kinase (abl) [56166] (1 species)
   PTK group; Abl subfamily; non-membrane spanning protein tyrosine kinase

7. Species Mouse (Mus musculus) [TaxId:10090] [56167] (9 PDB entries)

8. Domain d2hzia_: 2hzi A: [165342]
   automated match to d1opja_
   complexed with jin

Details for d2hzia_

PDB Entry: 2hzi, 1.7 Å

PDB Description: Abl kinase domain in complex with PD180970

PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d2hzia_:

Sequence; same for both SEQRES and ATOM records:

>d2hzia_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]}
dkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmke
ikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqissame
ylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapesla
ynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelm
racwqwnpsdrpsfaeihqafetmfqes

Timeline for d2hzia_:

• d2hzia_ is new in SCOPe 2.01-stable
  
• d2hzia_ appears in SCOPe 2.02
  
• d2hzia_ appears in the current release, SCOPe 2.08