| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
| Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
| Protein Abelsone tyrosine kinase (abl) [56166] (1 species) PTK group; Abl subfamily; non-membrane spanning protein tyrosine kinase |
| Species Mouse (Mus musculus) [TaxId:10090] [56167] (9 PDB entries) |
| Domain d2hzia_: 2hzi A: [165342] automated match to d1opja_ complexed with jin |
PDB Entry: 2hzi (more details), 1.7 Å
SCOPe Domain Sequences for d2hzia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hzia_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]}
dkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmke
ikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqissame
ylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapesla
ynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelm
racwqwnpsdrpsfaeihqafetmfqes
Timeline for d2hzia_: