| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Ectromelia virus [TaxId:265874] [187832] (2 PDB entries) |
| Domain d2hzfb1: 2hzf B:1-107 [165341] Other proteins in same PDB: d2hzfa2, d2hzfb2 automated match to d1jhba_ |
PDB Entry: 2hzf (more details), 1.8 Å
SCOPe Domain Sequences for d2hzfb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hzfb1 c.47.1.0 (B:1-107) automated matches {Ectromelia virus [TaxId: 265874]}
maeefvqqrlannkvtifvkytcpfcrnaldilnkfsfkrgayeivdikefkpenelrdy
feqitggktvpriffgktsiggysdlleidnmdalgdilssigvlrt
Timeline for d2hzfb1: