SCOPe 2.01: Domain d2hzca_: 2hzc A:

Lineage for d2hzca_ (2hzc A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (68 proteins)

6. Protein automated matches [190332] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187155] (9 PDB entries)

8. Domain d2hzca_: 2hzc A: [165337]
   automated match to d1u2fa_
   complexed with p6g, zn

Details for d2hzca_

PDB Entry: 2hzc, 1.47 Å

PDB Description: Crystal structure of the N-terminal RRM of the U2AF large subunit

PDB Compounds: (A:) splicing factor u2af 65 kda subunit

SCOPe Domain Sequences for d2hzca_:

Sequence; same for both SEQRES and ATOM records:

>d2hzca_ d.58.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gplgsarrlyvgnipfgiteeammdffnaqmrlggltqapgnpvlavqinqdknfaflef
rsvdettqamafdgiifqgqslkirrp

Timeline for d2hzca_:

• d2hzca_ is new in SCOPe 2.01-stable
  
• d2hzca_ appears in SCOPe 2.02
  
• d2hzca_ appears in the current release, SCOPe 2.08, called d2hzca1