Lineage for d2hzca1 (2hzc A:148-229)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) 
Family d.58.7.1: Canonical RBD [54929] (70 proteins)
Pfam PF00076
Pfam PF13893
Protein Splicing factor U2AF 65 KDa subunit [54936] (2 species) Species Human (Homo sapiens) [TaxId:9606] [54937] (10 PDB entries) 
Domain d2hzca1: 2hzc A:148-229 [165337]
Other proteins in same PDB: d2hzca2
automated match to d1u2fa_
complexed with p6g, zn
Details for d2hzca1
PDB Entry: 2hzc (more details), 1.47 Å
PDB Description: Crystal structure of the N-terminal RRM of the U2AF large subunit
PDB Compounds: (A:) splicing factor u2af 65 kda subunitSCOPe Domain Sequences for d2hzca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hzca1 d.58.7.1 (A:148-229) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}
arrlyvgnipfgiteeammdffnaqmrlggltqapgnpvlavqinqdknfaflefrsvde
ttqamafdgiifqgqslkirrp
SCOPe Domain Coordinates for d2hzca1:
Click to download the PDB-style file with coordinates for d2hzca1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2hzca1:
- d2hzca1 first appeared in SCOPe 2.01, called d2hzca_
- d2hzca1 appears in SCOPe 2.07
View in 3D
