Lineage for d2hxsa1 (2hxs A:11-184)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2128604Species Human (Homo sapiens) [TaxId:9606] [186862] (124 PDB entries)
  8. 2128605Domain d2hxsa1: 2hxs A:11-184 [165331]
    Other proteins in same PDB: d2hxsa2
    automated match to d1d5ca_
    complexed with g3d, mg

Details for d2hxsa1

PDB Entry: 2hxs (more details), 1.1 Å

PDB Description: Crystal Structure of Rab28A GTPase in the Inactive (GDP-3'P-Bound) Form
PDB Compounds: (A:) Ras-related protein Rab-28

SCOPe Domain Sequences for d2hxsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hxsa1 c.37.1.0 (A:11-184) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rqlkivvlgdgasgktslttcfaqetfgkqykqtigldfflrritlpgnlnvtlqiwdig
gqtiggkmldkyiygaqgvllvyditnyqsfenledwytvvkkvseesetqplvalvgnk
idlehmrtikpekhlrfcqengfsshfvsaktgdsvflcfqkvaaeilgiklnk

SCOPe Domain Coordinates for d2hxsa1:

Click to download the PDB-style file with coordinates for d2hxsa1.
(The format of our PDB-style files is described here.)

Timeline for d2hxsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hxsa2