SCOPe 2.03: Domain d2hxaa_: 2hxa A:

Lineage for d2hxaa_ (2hxa A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Azurin [49530] (6 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [49533] (78 PDB entries)
   Uniprot P00282

8. Domain d2hxaa_: 2hxa A: [165326]
   automated match to d1azna_
   complexed with cu1

Details for d2hxaa_

PDB Entry: 2hxa, 2.21 Å

PDB Description: crystal structure of cu(i) azurin with the metal-binding loop sequence "ctfpghsalm" replaced with "csphqgagm", at ph3.5

PDB Compounds: (A:) Azurin

SCOPe Domain Sequences for d2hxaa_:

Sequence; same for both SEQRES and ATOM records:

>d2hxaa_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
csvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvvtd
gmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffcsphqgagmkg
tltlk

Timeline for d2hxaa_:

• d2hxaa_ first appeared in SCOPe 2.01
  
• d2hxaa_ appears in SCOPe 2.02
  
• d2hxaa_ appears in SCOPe 2.04
  
• d2hxaa_ appears in the current release, SCOPe 2.08