SCOPe 2.08: Domain d2hx1d1: 2hx1 D:1-283

Lineage for d2hx1d1 (2hx1 D:1-283)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (55 species)
   not a true protein

7. Species Cytophaga hutchinsonii [TaxId:985] [187831] (1 PDB entry)

8. Domain d2hx1d1: 2hx1 D:1-283 [165319]
   Other proteins in same PDB: d2hx1a2, d2hx1b2, d2hx1c2, d2hx1d2
   automated match to d1pw5a_
   complexed with cl, edo, epe, mg

Details for d2hx1d1

PDB Entry: 2hx1, 2.1 Å

PDB Description: crystal structure of possible sugar phosphatase, had superfamily (zp_00311070.1) from cytophaga hutchinsonii atcc 33406 at 2.10 a resolution

PDB Compounds: (D:) Predicted sugar phosphatases of the HAD superfamily

SCOPe Domain Sequences for d2hx1d1:

Sequence; same for both SEQRES and ATOM records:

>d2hx1d1 c.108.1.0 (D:1-283) automated matches {Cytophaga hutchinsonii [TaxId: 985]}
mqiesfksllpkykciffdafgvlktyngllpgientfdylkaqgqdyyivtndasrspe
qladsyhklglfsitadkiissgmitkeyidlkvdggivaylgtansanylvsdgikmlp
vsaiddsnigevnalvllddegfnwfhdlnktvnllrkrtipaivantdntypltktdva
iaiggvatmiesilgrrfirfgkpdsqmfmfaydmlrqkmeiskreilmvgdtlhtdilg
gnkfgldtalvltgntriddaetkikstgivpthicesaviel

Timeline for d2hx1d1:

• d2hx1d1 first appeared in SCOPe 2.01, called d2hx1d_
  
• d2hx1d1 appears in SCOPe 2.07