![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
![]() | Protein automated matches [190447] (55 species) not a true protein |
![]() | Species Cytophaga hutchinsonii [TaxId:985] [187831] (1 PDB entry) |
![]() | Domain d2hx1c1: 2hx1 C:1-283 [165318] Other proteins in same PDB: d2hx1a2, d2hx1b2, d2hx1c2, d2hx1d2 automated match to d1pw5a_ complexed with cl, edo, epe, mg |
PDB Entry: 2hx1 (more details), 2.1 Å
SCOPe Domain Sequences for d2hx1c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hx1c1 c.108.1.0 (C:1-283) automated matches {Cytophaga hutchinsonii [TaxId: 985]} mqiesfksllpkykciffdafgvlktyngllpgientfdylkaqgqdyyivtndasrspe qladsyhklglfsitadkiissgmitkeyidlkvdggivaylgtansanylvsdgikmlp vsaiddsnigevnalvllddegfnwfhdlnktvnllrkrtipaivantdntypltktdva iaiggvatmiesilgrrfirfgkpdsqmfmfaydmlrqkmeiskreilmvgdtlhtdilg gnkfgldtalvltgntriddaetkikstgivpthicesaviel
Timeline for d2hx1c1: