SCOPe 2.05: Domain d2hwua_: 2hwu A:

Lineage for d2hwua_ (2hwu A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein Uridine phosphorylase [53176] (5 species)

7. Species Salmonella typhimurium [TaxId:90371] [117656] (24 PDB entries)
   Uniprot P0A1F6

8. Domain d2hwua_: 2hwu A: [165310]
   automated match to d1ryza_
   complexed with po4, uri

Details for d2hwua_

PDB Entry: 2hwu, 2.91 Å

PDB Description: Crystal structure of the uridine phosphorylase from Salmonella typhimurium in complex with uridine and phosphate ion at 2.91A resolution

PDB Compounds: (A:) Uridine phosphorylase

SCOPe Domain Sequences for d2hwua_:

Sequence; same for both SEQRES and ATOM records:

>d2hwua_ c.56.2.1 (A:) Uridine phosphorylase {Salmonella typhimurium [TaxId: 90371]}
msksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgk
avivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgas
lhfapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrf
kgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesh
avkivveaarrll

Timeline for d2hwua_:

• d2hwua_ first appeared in SCOPe 2.01
  
• d2hwua_ appears in SCOPe 2.04
  
• d2hwua_ appears in SCOPe 2.06
  
• d2hwua_ appears in the current release, SCOPe 2.08