SCOPe 2.05: Domain d2hveb_: 2hve B:

Lineage for d2hveb_ (2hve B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)

7. Species Human (Homo sapiens), NDKA [TaxId:9606] [75437] (6 PDB entries)

8. Domain d2hveb_: 2hve B: [165307]
   automated match to d1jxva_
   complexed with adp; mutant

Details for d2hveb_

PDB Entry: 2hve, 2.4 Å

PDB Description: s120g mutant of human nucleoside diphosphate kinase a complexed with adp

PDB Compounds: (B:) Nucleoside Diphosphate Kinase A

SCOPe Domain Sequences for d2hveb_:

Sequence; same for both SEQRES and ATOM records:

>d2hveb_ d.58.6.1 (B:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDKA [TaxId: 9606]}
ancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpff
aglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihggd
svesaekeiglwfhpeelvdytscaqnwiye

Timeline for d2hveb_:

• d2hveb_ first appeared in SCOPe 2.01
  
• d2hveb_ appears in SCOPe 2.04
  
• d2hveb_ appears in SCOPe 2.06
  
• d2hveb_ appears in the current release, SCOPe 2.08