Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) |
Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
Protein Nucleoside diphosphate kinase, NDK [54921] (23 species) |
Species Human (Homo sapiens), NDKA [TaxId:9606] [75437] (6 PDB entries) |
Domain d2hveb_: 2hve B: [165307] automated match to d1jxva_ complexed with adp; mutant |
PDB Entry: 2hve (more details), 2.4 Å
SCOPe Domain Sequences for d2hveb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hveb_ d.58.6.1 (B:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDKA [TaxId: 9606]} ancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpff aglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihggd svesaekeiglwfhpeelvdytscaqnwiye
Timeline for d2hveb_: