Lineage for d2huua_ (2huu A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2898246Species Yellow fever mosquito (Aedes aegypti) [TaxId:7159] [186876] (5 PDB entries)
  8. 2898254Domain d2huua_: 2huu A: [165296]
    automated match to d2ch1a1
    complexed with 1bo, ala

Details for d2huua_

PDB Entry: 2huu (more details), 2.1 Å

PDB Description: crystal structure of aedes aegypti alanine glyoxylate aminotransferase in complex with alanine
PDB Compounds: (A:) Alanine glyoxylate aminotransferase

SCOPe Domain Sequences for d2huua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2huua_ c.67.1.0 (A:) automated matches {Yellow fever mosquito (Aedes aegypti) [TaxId: 7159]}
meykvtppavlreplvtpnkllmgpgpsnapqrvldamsrpilghlhpetlkimddikeg
vrylfqtnniatfclsasghggmeatlcnlledgdvilightghwgdrsadmatrygadv
rvvkskvgqslsldeirdallihkpsvlfltqgdsstgvlqglegvgalchqhncllivd
tvaslggapmfmdrweidamytgsqkvlgappgitpvsfshraverykrrntkvkvyywd
mslvgdywgcfgrpriyhhtisstllyglreaiamaceeglpaliarhedcakrlyrglq
dagfelyadpkdrlstvttikvpqgvdwlkaaqyamktylveisgglgptagqvfriglm
gqnattervdrvlqvfqeavaavkp

SCOPe Domain Coordinates for d2huua_:

Click to download the PDB-style file with coordinates for d2huua_.
(The format of our PDB-style files is described here.)

Timeline for d2huua_: