Lineage for d2hurf_ (2hur F:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2194362Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2194363Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2194364Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 2194384Species Escherichia coli [TaxId:562] [187827] (1 PDB entry)
  8. 2194390Domain d2hurf_: 2hur F: [165293]
    automated match to d1nhkr_
    complexed with so4

Details for d2hurf_

PDB Entry: 2hur (more details), 1.62 Å

PDB Description: Escherichia coli nucleoside diphosphate kinase
PDB Compounds: (F:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d2hurf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hurf_ d.58.6.1 (F:) Nucleoside diphosphate kinase, NDK {Escherichia coli [TaxId: 562]}
aiertfsiikpnavaknvignifarfeaagfkivgtkmlhltveqargfyaehdgkpffd
glvefmtsgpivvsvlegenavqrhrdllgatnpanalagtlradyadsltengthgsds
vesaareiayffgegevcprtr

SCOPe Domain Coordinates for d2hurf_:

Click to download the PDB-style file with coordinates for d2hurf_.
(The format of our PDB-style files is described here.)

Timeline for d2hurf_: