| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) ![]() |
| Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
| Protein Nucleoside diphosphate kinase, NDK [54921] (23 species) |
| Species Escherichia coli [TaxId:562] [187827] (1 PDB entry) |
| Domain d2hure_: 2hur E: [165292] automated match to d1nhkr_ complexed with so4 |
PDB Entry: 2hur (more details), 1.62 Å
SCOPe Domain Sequences for d2hure_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hure_ d.58.6.1 (E:) Nucleoside diphosphate kinase, NDK {Escherichia coli [TaxId: 562]}
aiertfsiikpnavaknvignifarfeaagfkivgtkmlhltveqargfyaehdgkpffd
glvefmtsgpivvsvlegenavqrhrdllgatnpanalagtlradyadsltengthgsds
vesaareiayffgegevcprtr
Timeline for d2hure_: