Lineage for d2hurc_ (2hur C:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1027566Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 1027567Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 1027568Protein Nucleoside diphosphate kinase, NDK [54921] (21 species)
  7. 1027581Species Escherichia coli [TaxId:562] [187827] (1 PDB entry)
  8. 1027584Domain d2hurc_: 2hur C: [165290]
    automated match to d1nhkr_
    complexed with so4

Details for d2hurc_

PDB Entry: 2hur (more details), 1.62 Å

PDB Description: Escherichia coli nucleoside diphosphate kinase
PDB Compounds: (C:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d2hurc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hurc_ d.58.6.1 (C:) Nucleoside diphosphate kinase, NDK {Escherichia coli [TaxId: 562]}
aiertfsiikpnavaknvignifarfeaagfkivgtkmlhltveqargfyaehdgkpffd
glvefmtsgpivvsvlegenavqrhrdllgatnpanalagtlradyadsltengthgsds
vesaareiayffgegevcprtr

SCOPe Domain Coordinates for d2hurc_:

Click to download the PDB-style file with coordinates for d2hurc_.
(The format of our PDB-style files is described here.)

Timeline for d2hurc_: