Lineage for d2asr__ (2asr -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.24: Four-helical up-and-down bundle [47161] (11 superfamilies) 
Superfamily a.24.2: Aspartate receptor, ligand-binding domain [47170] (1 family) 
Family a.24.2.1: Aspartate receptor, ligand-binding domain [47171] (1 protein) Protein Aspartate receptor, ligand-binding domain [47172] (2 species) 
Species Escherichia coli [TaxId:562] [47173] (1 PDB entry) 
Domain d2asr__: 2asr - [16529]
Details for d2asr__
PDB Entry: 2asr (more details), 2.3 Å
PDB Description: the three-dimensional structure of the aspartate receptor from escherichia coli
SCOP Domain Sequences for d2asr__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2asr__ a.24.2.1 (-) Aspartate receptor, ligand-binding domain {Escherichia coli}
ksfvvsnqlreqqgeltstwdlmlqtrinlsrsavrmmmdssnqqsnakvelldsarktl
aqaathykkfksmaplpemvatsrnidekyknyytaltelidyldygntgayfaqptqgm
qnamgerfaqyalsseklyrdi
SCOP Domain Coordinates for d2asr__:
Click to download the PDB-style file with coordinates for d2asr__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2asr__:
- d2asr__ appears in SCOP 1.57
- d2asr__ appears in the current release, SCOPe 2.08, called d2asra_
View in 3D