Lineage for d2hurb_ (2hur B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951071Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2951072Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 2951092Species Escherichia coli [TaxId:562] [187827] (1 PDB entry)
  8. 2951094Domain d2hurb_: 2hur B: [165289]
    automated match to d1nhkr_
    complexed with so4

Details for d2hurb_

PDB Entry: 2hur (more details), 1.62 Å

PDB Description: Escherichia coli nucleoside diphosphate kinase
PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d2hurb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hurb_ d.58.6.1 (B:) Nucleoside diphosphate kinase, NDK {Escherichia coli [TaxId: 562]}
aiertfsiikpnavaknvignifarfeaagfkivgtkmlhltveqargfyaehdgkpffd
glvefmtsgpivvsvlegenavqrhrdllgatnpanalagtlradyadsltengthgsds
vesaareiayffgegevcprtr

SCOPe Domain Coordinates for d2hurb_:

Click to download the PDB-style file with coordinates for d2hurb_.
(The format of our PDB-style files is described here.)

Timeline for d2hurb_: