Lineage for d2huna_ (2hun A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2095737Species Pyrococcus horikoshii OT3 [TaxId:70601] [187049] (1 PDB entry)
  8. 2095738Domain d2huna_: 2hun A: [165284]
    automated match to d1r66a_
    complexed with nad

Details for d2huna_

PDB Entry: 2hun (more details), 2.07 Å

PDB Description: Crystal structure of hypothetical protein PH0414 from Pyrococcus horikoshii OT3
PDB Compounds: (A:) 336aa long hypothetical dTDP-glucose 4,6-dehydratase

SCOPe Domain Sequences for d2huna_:

Sequence, based on SEQRES records: (download)

>d2huna_ c.2.1.0 (A:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
smkllvtggmgfigsnfiryilekhpdwevinidklgygsnpanlkdleddprytfvkgd
vadyelvkelvrkvdgvvhlaaeshvdrsisspeiflhsnvigtytllesirrenpevrf
vhvstdevygdilkgsftendrlmpsspysatkaasdmlvlgwtrtynlnasitrctnny
gpyqfpeklipktiiraslglkipiygtgknvrdwlyvedhvraielvllkgesreiyni
sageektnlevvkiilrlmgkgeelielvedrpghdlrysldswkitrdlkwrpkytfde
gikktidwylknewwwkplvderilhptpwkl

Sequence, based on observed residues (ATOM records): (download)

>d2huna_ c.2.1.0 (A:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
smkllvtggmgfigsnfiryilekhpdwevinidklgygsnpanlkdleddprytfvkgd
vadyelvkelvrkvdgvvhlaaeshvdrsisspeiflhsnvigtytllesirrenpevrf
vhvstdevygdilkgsftendrlmpsspysatkaasdmlvlgwtrtynlnasitrctnny
gpyqfpeklipktiiraslglkipiygtvrdwlyvedhvraielvllkgesreiynisag
eektnlevvkiilrlmgkgeelielvedrpghdlrysldswkitrdlkwrpkytfdegik
ktidwylknewwwkplvderilhptpwkl

SCOPe Domain Coordinates for d2huna_:

Click to download the PDB-style file with coordinates for d2huna_.
(The format of our PDB-style files is described here.)

Timeline for d2huna_: