Lineage for d1le4a_ (1le4 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2699447Superfamily a.24.1: Apolipoprotein [47162] (1 family) (S)
  5. 2699448Family a.24.1.1: Apolipoprotein [47163] (2 proteins)
    Can exist in a coiled-coil oligomeric form, see PDB entry 1AV1
    family may also include the five-helical bundle protein Apolipophorin-III
  6. 2699449Protein Apolipoprotein E [88703] (3 species)
  7. 2699461Species Human (Homo sapiens), E4 [TaxId:9606] [47169] (3 PDB entries)
  8. 2699464Domain d1le4a_: 1le4 A: [16528]
    mutant

Details for d1le4a_

PDB Entry: 1le4 (more details), 2.5 Å

PDB Description: structural basis for altered function in the common mutants of human apolipoprotein-e
PDB Compounds: (A:) apolipoprotein e4

SCOPe Domain Sequences for d1le4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1le4a_ a.24.1.1 (A:) Apolipoprotein E {Human (Homo sapiens), E4 [TaxId: 9606]}
qrwelalgrfwdylrwvqtlseqvqeellssqvtqelralmdetmkelkaykseleeqlt
pvaeetrarlskelqaaqarlgadmedvrgrlvqyrgevqamlgqsteelrvrlashlrk
lrkrllrdaddlqkrlavy

SCOPe Domain Coordinates for d1le4a_:

Click to download the PDB-style file with coordinates for d1le4a_.
(The format of our PDB-style files is described here.)

Timeline for d1le4a_: