Lineage for d2huib_ (2hui B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2505814Species Yellow fever mosquito (Aedes aegypti) [TaxId:7159] [186876] (5 PDB entries)
  8. 2505821Domain d2huib_: 2hui B: [165279]
    automated match to d2ch1a1
    complexed with glv

Details for d2huib_

PDB Entry: 2hui (more details), 1.75 Å

PDB Description: crystal structure of aedes aegypti alanine glyoxylate aminotransferase in complex with glyoxylic acid
PDB Compounds: (B:) Alanine glyoxylate aminotransferase

SCOPe Domain Sequences for d2huib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2huib_ c.67.1.0 (B:) automated matches {Yellow fever mosquito (Aedes aegypti) [TaxId: 7159]}
meykvtppavlreplvtpnkllmgpgpsnapqrvldamsrpilghlhpetlkimddikeg
vrylfqtnniatfclsasghggmeatlcnlledgdvilightghwgdrsadmatrygadv
rvvkskvgqslsldeirdallihkpsvlfltqgdsstgvlqglegvgalchqhncllivd
tvaslggapmfmdrweidamytgsqkvlgappgitpvsfshraverykrrntkvkvyywd
mslvgdywgcfgrpriyhhtisstllyglreaiamaceeglpaliarhedcakrlyrglq
dagfelyadpkdrlstvttikvpqgvdwlkaaqyamktylveisgglgptagqvfriglm
gqnattervdrvlqvfqeavaavkp

SCOPe Domain Coordinates for d2huib_:

Click to download the PDB-style file with coordinates for d2huib_.
(The format of our PDB-style files is described here.)

Timeline for d2huib_: