![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
![]() | Protein automated matches [190151] (25 species) not a true protein |
![]() | Species Yellow fever mosquito (Aedes aegypti) [TaxId:7159] [186876] (5 PDB entries) |
![]() | Domain d2hufb_: 2huf B: [165277] automated match to d2ch1a1 complexed with 1bo |
PDB Entry: 2huf (more details), 1.75 Å
SCOPe Domain Sequences for d2hufb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hufb_ c.67.1.0 (B:) automated matches {Yellow fever mosquito (Aedes aegypti) [TaxId: 7159]} meykvtppavlreplvtpnkllmgpgpsnapqrvldamsrpilghlhpetlkimddikeg vrylfqtnniatfclsasghggmeatlcnlledgdvilightghwgdrsadmatrygadv rvvkskvgqslsldeirdallihkpsvlfltqgdsstgvlqglegvgalchqhncllivd tvaslggapmfmdrweidamytgsqkvlgappgitpvsfshraverykrrntkvkvyywd mslvgdywgcfgrpriyhhtisstllyglreaiamaceeglpaliarhedcakrlyrglq dagfelyadpkdrlstvttikvpqgvdwlkaaqyamktylveisgglgptagqvfriglm gqnattervdrvlqvfqeavaavkp
Timeline for d2hufb_: