Lineage for d1le2__ (1le2 -)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 279291Fold a.24: Four-helical up-and-down bundle [47161] (16 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 279292Superfamily a.24.1: Apolipoprotein [47162] (1 family) (S)
  5. 279293Family a.24.1.1: Apolipoprotein [47163] (1 protein)
    Can exist in a coiled-coil oligomeric form, see PDB entry 1AV1
    family may also include the five-helical bundle protein Apolipophorin-III
  6. 279294Protein Apolipoprotein E [88703] (3 species)
  7. 279295Species Human (Homo sapiens), E2 [TaxId:9606] [47167] (2 PDB entries)
  8. 279297Domain d1le2__: 1le2 - [16527]
    mutant

Details for d1le2__

PDB Entry: 1le2 (more details), 3 Å

PDB Description: structural basis for altered function in the common mutants of human apolipoprotein-e

SCOP Domain Sequences for d1le2__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1le2__ a.24.1.1 (-) Apolipoprotein E {Human (Homo sapiens), E2}
gqrwelalgrfwdylrwvqtlseqvqeellssqvtqelralmdetmkelkaykseleeql
tpvaeetrarlskelqaaqarlgadmedvcgrlvqyrgevqamlgqsteelrvrlashlr
klrkrllrdaddlqkclavyqaga

SCOP Domain Coordinates for d1le2__:

Click to download the PDB-style file with coordinates for d1le2__.
(The format of our PDB-style files is described here.)

Timeline for d1le2__: