Lineage for d2hu4b_ (2hu4 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807606Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2807607Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2808129Family b.68.1.0: automated matches [191452] (1 protein)
    not a true family
  6. 2808130Protein automated matches [190692] (20 species)
    not a true protein
  7. 2808214Species Influenza A virus, different strains [TaxId:11320] [188445] (32 PDB entries)
  8. 2808291Domain d2hu4b_: 2hu4 B: [165268]
    automated match to d1a14n_
    complexed with g39

Details for d2hu4b_

PDB Entry: 2hu4 (more details), 2.5 Å

PDB Description: n1 neuraminidase in complex with oseltamivir 2
PDB Compounds: (B:) Neuraminidase

SCOPe Domain Sequences for d2hu4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hu4b_ b.68.1.0 (B:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd
khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga
vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk
vvksveldapnyhyeecscypnageitcvcrdnwhgsnrpwvsfnqnleyqigyicsgvf
gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte
tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss
isfcgvnsdtvgwswpdgaelpfti

SCOPe Domain Coordinates for d2hu4b_:

Click to download the PDB-style file with coordinates for d2hu4b_.
(The format of our PDB-style files is described here.)

Timeline for d2hu4b_: