Class b: All beta proteins [48724] (177 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.1: Sialidases [50939] (3 families) |
Family b.68.1.0: automated matches [191452] (1 protein) not a true family |
Protein automated matches [190692] (15 species) not a true protein |
Species Influenza A virus [TaxId:11320] [188445] (31 PDB entries) |
Domain d2hu0h_: 2hu0 H: [165266] automated match to d1a14n_ complexed with g39 |
PDB Entry: 2hu0 (more details), 2.95 Å
SCOPe Domain Sequences for d2hu0h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hu0h_ b.68.1.0 (H:) automated matches {Influenza A virus [TaxId: 11320]} vklagnsslcpingwavyskdnsirigskgdvfvirepfiscshlecrtffltqgallnd khsngtvkdrsphrtlmscpvgeapspynsrfesvawsasachdgtswltigisgpdnga vavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifkmekgk vvksveldapnyhyeecscypnageitcvcrdnwhgsnrpwvsfnqnleyqigyicsgvf gdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstnsrsgfemiwdpngwte tdssfsvkqdivaitdwsgysgsfvqhpeltgldcirpcfwvelirgrpkestiwtsgss isfcgvnsdtvgwswpdgaelpfti
Timeline for d2hu0h_: