Lineage for d1nfo__ (1nfo -)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.24: Four-helical up-and-down bundle [47161] (12 superfamilies) 
Superfamily a.24.1: Apolipoprotein [47162] (1 family) 
Family a.24.1.1: Apolipoprotein [47163] (3 proteins) 
Protein Apolipoprotein E2 [47166] (1 species) Species Human (Homo sapiens) [TaxId:9606] [47167] (2 PDB entries) 
Domain d1nfo__: 1nfo - [16526]
Details for d1nfo__
PDB Entry: 1nfo (more details), 2 Å
PDB Description: apolipoprotein e2 (apoe2, d154a mutation)
SCOP Domain Sequences for d1nfo__:
Sequence, based on SEQRES records: (download)
>d1nfo__ a.24.1.1 (-) Apolipoprotein E2 {Human (Homo sapiens)}
gqrwelalgrfwdylrwvqtlseqvqeellssqvtqelralmdetmkelkaykseleeql
tpvaeetrarlskelqaaqarlgadmedvcgrlvqyrgevqamlgqsteelrvrlashlr
klrkrllrdadalqkclavyq
Sequence, based on observed residues (ATOM records): (download)
>d1nfo__ a.24.1.1 (-) Apolipoprotein E2 {Human (Homo sapiens)}
gqrwelalgrfwdylrwvqtlseqvqeellssqvtqelralmdetmkelkaykseleeqr
lskelqaaqarlgadmedvcgrlvqyrgevqamlgqsteelrvrlashlrklrkrllrda
dalqkclavyq
SCOP Domain Coordinates for d1nfo__:
Click to download the PDB-style file with coordinates for d1nfo__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nfo__:
- d1nfo__ first appeared (with stable ids) in SCOP 1.55
- d1nfo__ appears in SCOP 1.59
- d1nfo__ appears in the current release, SCOPe 2.08, called d1nfoa_
View in 3D