Lineage for d1nfo__ (1nfo -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2246Fold a.24: Four-helical up-and-down bundle [47161] (11 superfamilies)
  4. 2247Superfamily a.24.1: Apolipoprotein [47162] (1 family) (S)
  5. 2248Family a.24.1.1: Apolipoprotein [47163] (3 proteins)
  6. 2249Protein Apolipoprotein E2 [47166] (1 species)
  7. 2250Species Human (Homo sapiens) [TaxId:9606] [47167] (2 PDB entries)
  8. 2251Domain d1nfo__: 1nfo - [16526]

Details for d1nfo__

PDB Entry: 1nfo (more details), 2 Å

PDB Description: apolipoprotein e2 (apoe2, d154a mutation)

SCOP Domain Sequences for d1nfo__:

Sequence, based on SEQRES records: (download)

>d1nfo__ a.24.1.1 (-) Apolipoprotein E2 {Human (Homo sapiens)}
gqrwelalgrfwdylrwvqtlseqvqeellssqvtqelralmdetmkelkaykseleeql
tpvaeetrarlskelqaaqarlgadmedvcgrlvqyrgevqamlgqsteelrvrlashlr
klrkrllrdadalqkclavyq

Sequence, based on observed residues (ATOM records): (download)

>d1nfo__ a.24.1.1 (-) Apolipoprotein E2 {Human (Homo sapiens)}
gqrwelalgrfwdylrwvqtlseqvqeellssqvtqelralmdetmkelkaykseleeqr
lskelqaaqarlgadmedvcgrlvqyrgevqamlgqsteelrvrlashlrklrkrllrda
dalqkclavyq

SCOP Domain Coordinates for d1nfo__:

Click to download the PDB-style file with coordinates for d1nfo__.
(The format of our PDB-style files is described here.)

Timeline for d1nfo__: