Lineage for d2htva_ (2htv A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2398193Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2398194Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2398637Family b.68.1.0: automated matches [191452] (1 protein)
    not a true family
  6. 2398638Protein automated matches [190692] (15 species)
    not a true protein
  7. 2398698Species Influenza A virus, different strains [TaxId:11320] [188445] (32 PDB entries)
  8. 2398782Domain d2htva_: 2htv A: [165249]
    automated match to d2bata_
    complexed with ca, nag

Details for d2htva_

PDB Entry: 2htv (more details), 2.8 Å

PDB Description: N4 neuraminidase
PDB Compounds: (A:) Neuraminidase

SCOPe Domain Sequences for d2htva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2htva_ b.68.1.0 (A:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
vihyssgkdlcpvkgwaplskdngirigsrgevfvirepfiscsinecrtffltqgalln
dkhsngtvkdrspfrtlmscpigvapspsnsrfesvawsatacsdgpgwltigitgpdat
avavlkyngiitdtlkswkgnimrtqesecvcqdefcytlitdgpsdaqafykilkikkg
kivsvkdvdapgfhfeecscypsgenvecvcrdnwrgsnrpwirfnsdldyqigyvcsgv
fgdnprpmdstgscnspinngkgrygvkgfsfrygdgvwigrtkslesrsgfemvwdang
wvstdkdsngvqdiidndnwsgysgsfsirgettgrnctvpcfwvemirgqpkektiwts
gssiafcgvnsdttgwswpdgallpfdi

SCOPe Domain Coordinates for d2htva_:

Click to download the PDB-style file with coordinates for d2htva_.
(The format of our PDB-style files is described here.)

Timeline for d2htva_: