SCOPe 2.05: Domain d2htua_: 2htu A:

Lineage for d2htua_ (2htu A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.1: Sialidases [50939] (3 families)

5. Family b.68.1.0: automated matches [191452] (1 protein)
   not a true family

6. Protein automated matches [190692] (11 species)
   not a true protein

7. Species Influenza A virus [TaxId:11320] [188445] (31 PDB entries)

8. Domain d2htua_: 2htu A: [165248]
   automated match to d1inga_
   complexed with bcz

Details for d2htua_

PDB Entry: 2htu, 2.2 Å

PDB Description: N8 neuraminidase in complex with peramivir

PDB Compounds: (A:) Neuraminidase

SCOPe Domain Sequences for d2htua_:

Sequence; same for both SEQRES and ATOM records:

>d2htua_ b.68.1.0 (A:) automated matches {Influenza A virus [TaxId: 11320]}
tymnnteaicdakgfapfskdngirigsrghifvirepfvscspiecrtffltqgsllnd
khsngtvkdrspfrtlmsvevgqspnvyqarfeavawsatachdgkkwmtvgvtgpdska
vavihyggvptdvvnswagdilrtqessctciqgdcywvmtdgpanrqaqyriykanqgr
iigqtdisfngghieecscypndgkvecvcrdgwtgtnrpvlvispdlsyrvgylcagip
sdtprgedtqftgsctspmgnqgygvkgfgfrqgtdvwmgrtisrtsrsgfeilrikngw
tqtskeqirkqvvvdnlnwsgysgsftlpvelsgkdclvpcfwvemirgkpeektiwtss
ssivmcgvdyevadwswhdgailpfdi

Timeline for d2htua_:

• d2htua_ first appeared in SCOPe 2.01
  
• d2htua_ appears in SCOPe 2.04
  
• d2htua_ appears in SCOPe 2.06
  
• d2htua_ appears in the current release, SCOPe 2.08