Lineage for d2ht7a_ (2ht7 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2398193Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2398194Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2398637Family b.68.1.0: automated matches [191452] (1 protein)
    not a true family
  6. 2398638Protein automated matches [190692] (14 species)
    not a true protein
  7. 2398698Species Influenza A virus, different strains [TaxId:11320] [188445] (31 PDB entries)
  8. 2398768Domain d2ht7a_: 2ht7 A: [165241]
    automated match to d1inga_
    complexed with g39

Details for d2ht7a_

PDB Entry: 2ht7 (more details), 2.6 Å

PDB Description: N8 neuraminidase in open complex with oseltamivir
PDB Compounds: (A:) Neuraminidase

SCOPe Domain Sequences for d2ht7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ht7a_ b.68.1.0 (A:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
tymnnteaicdakgfapfskdngirigsrghifvirepfvscspiecrtffltqgsllnd
khsngtvkdrspfrtlmsvevgqspnvyqarfeavawsatachdgkkwmtvgvtgpdska
vavihyggvptdvvnswagdilrtqessctciqgdcywvmtdgpanrqaqyriykanqgr
iigqtdisfngghieecscypndgkvecvcrdgwtgtnrpvlvispdlsyrvgylcagip
sdtprgedtqftgsctspmgnqgygvkgfgfrqgtdvwmgrtisrtsrsgfeilrikngw
tqtskeqirkqvvvdnlnwsgysgsftlpvelsgkdclvpcfwvemirgkpeektiwtss
ssivmcgvdyevadwswhdgailpfdi

SCOPe Domain Coordinates for d2ht7a_:

Click to download the PDB-style file with coordinates for d2ht7a_.
(The format of our PDB-style files is described here.)

Timeline for d2ht7a_: