| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein GTP-binding protein GEM [142289] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [142290] (2 PDB entries) Uniprot P55040 73-244 |
| Domain d2ht6b_: 2ht6 B: [165240] automated match to d2g3ya1 complexed with gdp, mg |
PDB Entry: 2ht6 (more details), 2.4 Å
SCOPe Domain Sequences for d2ht6b_:
Sequence, based on SEQRES records: (download)
>d2ht6b_ c.37.1.8 (B:) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]}
tyyrvvligeqgvgkstlanifagvhdsmdsdcevlgedtyertlmvdgesatiilldmw
enkgenewlhdhcmqvgdaylivysitdrasfekaselriqlrrarqtedipiilvgnks
dlvrcrevsvsegracavvfdckfietsaavqhnvkelfegivrqvrlrr
>d2ht6b_ c.37.1.8 (B:) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]}
tyyrvvligeqgvgkstlanifagvhsdcevlgedtyertlmvdgesatiilldmwenke
newlhdhcmqvgdaylivysitdrasfekaselriqlrrarqtedipiilvgnksdlvrc
revsvsegracavvfdckfietsaavqhnvkelfegivrqvrlrr
Timeline for d2ht6b_: