Lineage for d1lpea_ (1lpe A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1726514Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1726515Superfamily a.24.1: Apolipoprotein [47162] (1 family) (S)
  5. 1726516Family a.24.1.1: Apolipoprotein [47163] (1 protein)
    Can exist in a coiled-coil oligomeric form, see PDB entry 1AV1
    family may also include the five-helical bundle protein Apolipophorin-III
  6. 1726517Protein Apolipoprotein E [88703] (3 species)
  7. 1726521Species Human (Homo sapiens), E3 [TaxId:9606] [47165] (7 PDB entries)
  8. 1726525Domain d1lpea_: 1lpe A: [16524]

Details for d1lpea_

PDB Entry: 1lpe (more details), 2.25 Å

PDB Description: three-dimensional structure of the ldl receptor-binding domain of human apolipoprotein e
PDB Compounds: (A:) apolipoprotein e3

SCOPe Domain Sequences for d1lpea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lpea_ a.24.1.1 (A:) Apolipoprotein E {Human (Homo sapiens), E3 [TaxId: 9606]}
gqrwelalgrfwdylrwvqtlseqvqeellssqvtqelralmdetmkelkaykseleeql
tpvaeetrarlskelqaaqarlgadmedvcgrlvqyrgevqamlgqsteelrvrlashlr
klrkrllrdaddlqkrlavyqaga

SCOPe Domain Coordinates for d1lpea_:

Click to download the PDB-style file with coordinates for d1lpea_.
(The format of our PDB-style files is described here.)

Timeline for d1lpea_: