| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.1: Apolipoprotein [47162] (1 family) ![]() |
| Family a.24.1.1: Apolipoprotein [47163] (2 proteins) Can exist in a coiled-coil oligomeric form, see PDB entry 1AV1 family may also include the five-helical bundle protein Apolipophorin-III |
| Protein Apolipoprotein E [88703] (3 species) |
| Species Human (Homo sapiens), E3 [TaxId:9606] [47165] (7 PDB entries) |
| Domain d1lpea_: 1lpe A: [16524] |
PDB Entry: 1lpe (more details), 2.25 Å
SCOPe Domain Sequences for d1lpea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lpea_ a.24.1.1 (A:) Apolipoprotein E {Human (Homo sapiens), E3 [TaxId: 9606]}
gqrwelalgrfwdylrwvqtlseqvqeellssqvtqelralmdetmkelkaykseleeql
tpvaeetrarlskelqaaqarlgadmedvcgrlvqyrgevqamlgqsteelrvrlashlr
klrkrllrdaddlqkrlavyqaga
Timeline for d1lpea_: