SCOPe 2.05: Domain d2ht6a_: 2ht6 A:

Lineage for d2ht6a_ (2ht6 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein GTP-binding protein GEM [142289] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142290] (2 PDB entries)
   Uniprot P55040 73-244

8. Domain d2ht6a_: 2ht6 A: [165239]
   automated match to d2g3ya1
   complexed with gdp, mg

Details for d2ht6a_

PDB Entry: 2ht6, 2.4 Å

PDB Description: Crystal structure of Human Gem G-domain bound to GDP

PDB Compounds: (A:) GTP-binding protein gem

SCOPe Domain Sequences for d2ht6a_:

Sequence, based on SEQRES records:

>d2ht6a_ c.37.1.8 (A:) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]}
gntyyrvvligeqgvgkstlanifagvhdsmdsdcevlgedtyertlmvdgesatiilld
mwenkgenewlhdhcmqvgdaylivysitdrasfekaselriqlrrarqtedipiilvgn
ksdlvrcrevsvsegracavvfdckfietsaavqhnvkelfegivrqvrlrr

Sequence, based on observed residues (ATOM records):

>d2ht6a_ c.37.1.8 (A:) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]}
gntyyrvvligeqgvgkstlanifagvdsdcevlgedtyertlmvdgesatiilldmwen
knewlhdhcmqvgdaylivysitdrasfekaselriqlrrarqtedipiilvgnksdlvr
crevsvsegracavvfdckfietsaavqhnvkelfegivrqvrlrr

Timeline for d2ht6a_:

• d2ht6a_ first appeared in SCOPe 2.01
  
• d2ht6a_ appears in SCOPe 2.04
  
• d2ht6a_ appears in SCOPe 2.06
  
• d2ht6a_ appears in the current release, SCOPe 2.08