Lineage for d2ht5a_ (2ht5 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2064981Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2065391Family b.68.1.0: automated matches [191452] (1 protein)
    not a true family
  6. 2065392Protein automated matches [190692] (15 species)
    not a true protein
  7. 2065420Species Influenza A virus [TaxId:11320] [188445] (31 PDB entries)
  8. 2065450Domain d2ht5a_: 2ht5 A: [165238]
    automated match to d1inga_
    complexed with ca, ndg

Details for d2ht5a_

PDB Entry: 2ht5 (more details), 2.4 Å

PDB Description: N8 Neuraminidase
PDB Compounds: (A:) Neuraminidase

SCOPe Domain Sequences for d2ht5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ht5a_ b.68.1.0 (A:) automated matches {Influenza A virus [TaxId: 11320]}
tymnnteaicdakgfapfskdngirigsrghifvirepfvscspiecrtffltqgsllnd
khsngtvkdrspfrtlmsvevgqspnvyqarfeavawsatachdgkkwmtvgvtgpdska
vavihyggvptdvvnswagdilrtqessctciqgdcywvmtdgpanrqaqyriykanqgr
iigqtdisfngghieecscypndgkvecvcrdgwtgtnrpvlvispdlsyrvgylcagip
sdtprgedtqftgsctspmgnqgygvkgfgfrqgtdvwmgrtisrtsrsgfeilrikngw
tqtskeqirkqvvvdnlnwsgysgsftlpvelsgkdclvpcfwvemirgkpeektiwtss
ssivmcgvdyevadwswhdgailpfdi

SCOPe Domain Coordinates for d2ht5a_:

Click to download the PDB-style file with coordinates for d2ht5a_.
(The format of our PDB-style files is described here.)

Timeline for d2ht5a_: