Lineage for d2hs8a_ (2hs8 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080389Protein automated matches [190228] (18 species)
    not a true protein
  7. 2080474Species Solanum lycopersicum [TaxId:4081] [187823] (5 PDB entries)
  8. 2080481Domain d2hs8a_: 2hs8 A: [165232]
    automated match to d1q45a_
    complexed with fmn; mutant

Details for d2hs8a_

PDB Entry: 2hs8 (more details), 1.9 Å

PDB Description: Crystal structure of the Y364F mutant of 12-oxophytodienoate reductase 3 from tomato
PDB Compounds: (A:) 12-oxophytodienoate reductase 3

SCOPe Domain Sequences for d2hs8a_:

Sequence, based on SEQRES records: (download)

>d2hs8a_ c.1.4.1 (A:) automated matches {Solanum lycopersicum [TaxId: 4081]}
dgnnplfspykmgkfnlshrvvlapmtrcralnnipqaalgeyyeqrataggflitegtm
isptsagfphvpgiftkeqvrewkkivdvvhakgavifcqlwhvgrashevyqpagaapi
sstekpisnrwrilmpdgthgiypkpraigtyeisqvvedyrrsalnaieagfdgieihg
ahgylidqflkdgindrtdeyggslanrckfitqvvqavvsaigadrvgvrvspaidhld
amdsnplslglavverlnkiqlhsgsklaylhvtqpryvaygqteagrlgseeeearlmr
tlrnayqgtficsggytrelgieavaqgdadlvsygrlfisnpdlvmriklnaplnkfnr
ktfytqdpvvgytdypfl

Sequence, based on observed residues (ATOM records): (download)

>d2hs8a_ c.1.4.1 (A:) automated matches {Solanum lycopersicum [TaxId: 4081]}
dgnnplfspykmgkfnlshrvvlapmtrcralnnipqaalgeyyeqrataggflitegtm
isptsagfphvpgiftkeqvrewkkivdvvhakgavifcqlwhvgrashevyqpagaapi
sstekpisnrwrilmpdgthgiypkpraigtyeisqvvedyrrsalnaieagfdgieihg
ahgylidqflkdgindrtdeyggslanrckfitqvvqavvsaigadrvgvrvspaidhld
amdsnplslglavverlnkiqlhsgsklaylhvtqprlgseeeearlmrtlrnayqgtfi
csggytrelgieavaqgdadlvsygrlfisnpdlvmriklnaplnkfnrktfytqdpvvg
ytdypfl

SCOPe Domain Coordinates for d2hs8a_:

Click to download the PDB-style file with coordinates for d2hs8a_.
(The format of our PDB-style files is described here.)

Timeline for d2hs8a_: