Lineage for d2hrwa_ (2hrw A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088020Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2088358Family c.1.12.0: automated matches [191427] (1 protein)
    not a true family
  6. 2088359Protein automated matches [190614] (15 species)
    not a true protein
  7. 2088427Species Variovorax sp. [TaxId:218557] [187638] (3 PDB entries)
  8. 2088430Domain d2hrwa_: 2hrw A: [165225]
    automated match to d1s2vb_
    complexed with cl, na

Details for d2hrwa_

PDB Entry: 2hrw (more details), 2.2 Å

PDB Description: crystal structure of phosphonopyruvate hydrolase
PDB Compounds: (A:) Phosphonopyruvate hydrolase

SCOPe Domain Sequences for d2hrwa_:

Sequence, based on SEQRES records: (download)

>d2hrwa_ c.1.12.0 (A:) automated matches {Variovorax sp. [TaxId: 218557]}
mtknqalraaldsgrlftamaahnplvaklaeqagfggiwgsgfelsasyavpdanilsm
sthlemmraiastvsipliadidtgfgnavnvhyvvpqyeaagasaivmedktfpkdtsl
rtdgrqelvrieefqgkiaaataaradrdfvviarvealiaglgqqeavrrgqayeeaga
dailihsrqktpdeilafvkswpgkvplvlvptaypqlteadiaalskvgiviygnhair
aavgavrevfarirrdggirevdaalpsvkeiielqgdermravearylk

Sequence, based on observed residues (ATOM records): (download)

>d2hrwa_ c.1.12.0 (A:) automated matches {Variovorax sp. [TaxId: 218557]}
mtknqalraaldsgrlftamaahnplvaklaeqagfggiwgsgfelsasyavpdanilsm
sthlemmraiastvsipliadidtgfgnavnvhyvvpqyeaagasaivmedktfpkqelv
rieefqgkiaaataaradrdfvviarvealiaglgqqeavrrgqayeeagadailihsrq
ktpdeilafvkswpgkvplvlvptaypqlteadiaalskvgiviygnhairaavgavrev
farirrdggirevdaalpsvkeiielqgdermravearylk

SCOPe Domain Coordinates for d2hrwa_:

Click to download the PDB-style file with coordinates for d2hrwa_.
(The format of our PDB-style files is described here.)

Timeline for d2hrwa_: