Lineage for d2hrec_ (2hre C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2519619Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2519620Superfamily c.92.1: Chelatase [53800] (4 families) (S)
    interdomain linker is short; swapping of C-terminal helices between the two domains
  5. 2519621Family c.92.1.1: Ferrochelatase [53801] (2 proteins)
    automatically mapped to Pfam PF00762
  6. 2519622Protein Ferrochelatase [53802] (3 species)
  7. 2519645Species Human (Homo sapiens) [TaxId:9606] [64189] (21 PDB entries)
  8. 2519678Domain d2hrec_: 2hre C: [165222]
    automated match to d1hrka_
    complexed with chd, fes, pp9

Details for d2hrec_

PDB Entry: 2hre (more details), 2.5 Å

PDB Description: structure of human ferrochelatase variant e343k with protoporphyrin ix bound
PDB Compounds: (C:) Ferrochelatase

SCOPe Domain Sequences for d2hrec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hrec_ c.92.1.1 (C:) Ferrochelatase {Human (Homo sapiens) [TaxId: 9606]}
rkpktgilmlnmggpetlgdvhdfllrlfldrdlmtlpiqnklapfiakrrtpkiqeqyr
rigggspikiwtskqgegmvklldelspntaphkyyigfryvhplteeaieemerdgler
aiaftqypqyscsttgsslnaiyryynqvgrkptmkwstidrwpthhlliqcfadhilke
ldhfplekrsevvilfsahslpmsvvnrgdpypqevsatvqkvmerleycnpyrlvwqsk
vgpmpwlgpqtdesikglcergrknillvpiaftsdhiktlyeldieysqvlakecgven
irraeslngnplfskaladlvhshiqsnelcskqltlscplcvnpvcretksfftsqql

SCOPe Domain Coordinates for d2hrec_:

Click to download the PDB-style file with coordinates for d2hrec_.
(The format of our PDB-style files is described here.)

Timeline for d2hrec_: