Lineage for d1or3a_ (1or3 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312794Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2312795Superfamily a.24.1: Apolipoprotein [47162] (1 family) (S)
  5. 2312796Family a.24.1.1: Apolipoprotein [47163] (2 proteins)
    Can exist in a coiled-coil oligomeric form, see PDB entry 1AV1
    family may also include the five-helical bundle protein Apolipophorin-III
  6. 2312797Protein Apolipoprotein E [88703] (3 species)
  7. 2312801Species Human (Homo sapiens), E3 [TaxId:9606] [47165] (7 PDB entries)
  8. 2312806Domain d1or3a_: 1or3 A: [16522]
    truncation mutant 165
    mutant

Details for d1or3a_

PDB Entry: 1or3 (more details), 1.73 Å

PDB Description: apolipoprotein e3 (apoe3), trigonal truncation mutant 165
PDB Compounds: (A:) protein (apolipoprotein e)

SCOPe Domain Sequences for d1or3a_:

Sequence, based on SEQRES records: (download)

>d1or3a_ a.24.1.1 (A:) Apolipoprotein E {Human (Homo sapiens), E3 [TaxId: 9606]}
sgqrwelalgrfwdylrwvqtlseqvqeellssqvtqelralmdetmkelkaykseleeq
ltpvaeetrarlskelqaaqarlgadmedvcgrlvqyrgevqamlgqsteelrvrlashl
rklrkrllrdaddlqkrlavyqa

Sequence, based on observed residues (ATOM records): (download)

>d1or3a_ a.24.1.1 (A:) Apolipoprotein E {Human (Homo sapiens), E3 [TaxId: 9606]}
sgqrwelalgrfwdylrwvqtlseqvqeellssqvtqelralmdetmkelkaykseleeq
ltarlskelqaaqarlgadmedvcgrlvqyrgevqamlgqsteelrvrlashlrklrkrl
lrdaddlqkrlavyqa

SCOPe Domain Coordinates for d1or3a_:

Click to download the PDB-style file with coordinates for d1or3a_.
(The format of our PDB-style files is described here.)

Timeline for d1or3a_: