Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins) |
Protein Uridine phosphorylase [53176] (6 species) |
Species Salmonella typhimurium [TaxId:90371] [117656] (24 PDB entries) Uniprot P0A1F6 |
Domain d2hrdf_: 2hrd F: [165219] automated match to d1ryza_ complexed with 1pe, gol, po4, tdr |
PDB Entry: 2hrd (more details), 1.7 Å
SCOPe Domain Sequences for d2hrdf_:
Sequence, based on SEQRES records: (download)
>d2hrdf_ c.56.2.1 (F:) Uridine phosphorylase {Salmonella typhimurium [TaxId: 90371]} sksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgka vivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgasl hfapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfk gsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesha vkivveaarrll
>d2hrdf_ c.56.2.1 (F:) Uridine phosphorylase {Salmonella typhimurium [TaxId: 90371]} sksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgka vivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgasl hfapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfk gsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipneshavkivvea arrll
Timeline for d2hrdf_: