Lineage for d1bz4a_ (1bz4 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312794Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2312795Superfamily a.24.1: Apolipoprotein [47162] (1 family) (S)
  5. 2312796Family a.24.1.1: Apolipoprotein [47163] (2 proteins)
    Can exist in a coiled-coil oligomeric form, see PDB entry 1AV1
    family may also include the five-helical bundle protein Apolipophorin-III
  6. 2312797Protein Apolipoprotein E [88703] (3 species)
  7. 2312801Species Human (Homo sapiens), E3 [TaxId:9606] [47165] (7 PDB entries)
  8. 2312807Domain d1bz4a_: 1bz4 A: [16521]
    truncation mutant 165
    mutant

Details for d1bz4a_

PDB Entry: 1bz4 (more details), 1.85 Å

PDB Description: apolipoprotein e3 (apo-e3), truncation mutant 165
PDB Compounds: (A:) protein (apolipoprotein e)

SCOPe Domain Sequences for d1bz4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bz4a_ a.24.1.1 (A:) Apolipoprotein E {Human (Homo sapiens), E3 [TaxId: 9606]}
sgqrwelalgrfwdylrwvqtlseqvqeellssqvtqelralmdetmkelkaykseleeq
ltpvaeetrarlskelqaaqarlgadmedvcgrlvqyrgevqamlgqsteelrvrlashl
rklrkrllrdaddlqkrlavyqag

SCOPe Domain Coordinates for d1bz4a_:

Click to download the PDB-style file with coordinates for d1bz4a_.
(The format of our PDB-style files is described here.)

Timeline for d1bz4a_: