Class a: All alpha proteins [46456] (290 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.1: Apolipoprotein [47162] (1 family) |
Family a.24.1.1: Apolipoprotein [47163] (2 proteins) Can exist in a coiled-coil oligomeric form, see PDB entry 1AV1 family may also include the five-helical bundle protein Apolipophorin-III |
Protein Apolipoprotein E [88703] (3 species) |
Species Human (Homo sapiens), E3 [TaxId:9606] [47165] (7 PDB entries) |
Domain d1bz4a_: 1bz4 A: [16521] truncation mutant 165 mutant |
PDB Entry: 1bz4 (more details), 1.85 Å
SCOPe Domain Sequences for d1bz4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bz4a_ a.24.1.1 (A:) Apolipoprotein E {Human (Homo sapiens), E3 [TaxId: 9606]} sgqrwelalgrfwdylrwvqtlseqvqeellssqvtqelralmdetmkelkaykseleeq ltpvaeetrarlskelqaaqarlgadmedvcgrlvqyrgevqamlgqsteelrvrlashl rklrkrllrdaddlqkrlavyqag
Timeline for d1bz4a_: